TY - JOUR
T1 - Molecular cloning, complete nucleotide sequence, and gene structure of the provirus genome of a retrovirus produced in a human lymphoblastoid cell line
AU - Oda, Takuzo
AU - Ikeda, Shogo
AU - Watanabe, Sekiko
AU - Hatsushika, Masao
AU - Akiyama, Kosuke
AU - Mitsunobu, Fumihiro
PY - 1988/1/1
Y1 - 1988/1/1
N2 - We found and characterized a type D retrovirus produced in a human lymphoblastoid cell line of B-cell lineage. The amino acid sequence of the N-terminal region of the purified major structural protein (PVTRSQGQVSSNTTGRASPHPDTHTIPE) revealed no high homology with any of the known retroviral amino acid sequences. We have cloned cDNA and the proviral genome integrated in the retrovirus-producing cells, and determined the complete nucleotide sequence and gene structures of the genome. The provirus genome is 8785 by long and has the structure of LTR-gag-prt-pol-env-LTR. The nucleotide sequences of the long terminal repeat (LTR) region and a part of thepol gene were closely related to the available sequences of squirrel monkey retrovirus (SMRV), and we designated this virus SMRVHLB, abbreviated as SMRV-H. The primer (tRNA1,2Lys)-binding sequence of SMRV-H (TGGCGCCCAGGACGTGGGGCTCGA) has aGG insertion, which is different from that of SMRV. The transmembrane protein of the 3′ terminal region ofenv gene contains an amino acid sequence of an immunosuppressive peptide (EVVLQNRRGLDLLTAEQGGICLALQERCCFYANKS), in whichR is unique in SMRV-H. The core sequence of the glucocorticoid regulatory element is found upstream of the two 42-bp imperfect repeats in the LTR. Sequences partially homologous to those of the rat IgE-binding protein gene are in gag and pol genes.
AB - We found and characterized a type D retrovirus produced in a human lymphoblastoid cell line of B-cell lineage. The amino acid sequence of the N-terminal region of the purified major structural protein (PVTRSQGQVSSNTTGRASPHPDTHTIPE) revealed no high homology with any of the known retroviral amino acid sequences. We have cloned cDNA and the proviral genome integrated in the retrovirus-producing cells, and determined the complete nucleotide sequence and gene structures of the genome. The provirus genome is 8785 by long and has the structure of LTR-gag-prt-pol-env-LTR. The nucleotide sequences of the long terminal repeat (LTR) region and a part of thepol gene were closely related to the available sequences of squirrel monkey retrovirus (SMRV), and we designated this virus SMRVHLB, abbreviated as SMRV-H. The primer (tRNA1,2Lys)-binding sequence of SMRV-H (TGGCGCCCAGGACGTGGGGCTCGA) has aGG insertion, which is different from that of SMRV. The transmembrane protein of the 3′ terminal region ofenv gene contains an amino acid sequence of an immunosuppressive peptide (EVVLQNRRGLDLLTAEQGGICLALQERCCFYANKS), in whichR is unique in SMRV-H. The core sequence of the glucocorticoid regulatory element is found upstream of the two 42-bp imperfect repeats in the LTR. Sequences partially homologous to those of the rat IgE-binding protein gene are in gag and pol genes.
UR - http://www.scopus.com/inward/record.url?scp=0024230347&partnerID=8YFLogxK
UR - http://www.scopus.com/inward/citedby.url?scp=0024230347&partnerID=8YFLogxK
U2 - 10.1016/0042-6822(88)90109-2
DO - 10.1016/0042-6822(88)90109-2
M3 - Article
C2 - 3201749
AN - SCOPUS:0024230347
VL - 167
SP - 468
EP - 476
JO - Virology
JF - Virology
SN - 0042-6822
IS - 2
ER -