Molecular cloning, complete nucleotide sequence, and gene structure of the provirus genome of a retrovirus produced in a human lymphoblastoid cell line

Takuzo Oda, Shogo Ikeda, Sekiko Watanabe, Masao Hatsushika, Kosuke Akiyama, Fumihiro Mitsunobu

Research output: Contribution to journalArticle

31 Citations (Scopus)

Abstract

We found and characterized a type D retrovirus produced in a human lymphoblastoid cell line of B-cell lineage. The amino acid sequence of the N-terminal region of the purified major structural protein (PVTRSQGQVSSNTTGRASPHPDTHTIPE) revealed no high homology with any of the known retroviral amino acid sequences. We have cloned cDNA and the proviral genome integrated in the retrovirus-producing cells, and determined the complete nucleotide sequence and gene structures of the genome. The provirus genome is 8785 by long and has the structure of LTR-gag-prt-pol-env-LTR. The nucleotide sequences of the long terminal repeat (LTR) region and a part of thepol gene were closely related to the available sequences of squirrel monkey retrovirus (SMRV), and we designated this virus SMRVHLB, abbreviated as SMRV-H. The primer (tRNA1,2Lys)-binding sequence of SMRV-H (TGGCGCCCAGGACGTGGGGCTCGA) has aGG insertion, which is different from that of SMRV. The transmembrane protein of the 3′ terminal region ofenv gene contains an amino acid sequence of an immunosuppressive peptide (EVVLQNRRGLDLLTAEQGGICLALQERCCFYANKS), in whichR is unique in SMRV-H. The core sequence of the glucocorticoid regulatory element is found upstream of the two 42-bp imperfect repeats in the LTR. Sequences partially homologous to those of the rat IgE-binding protein gene are in gag and pol genes.

Original languageEnglish
Pages (from-to)468-476
Number of pages9
JournalVirology
Volume167
Issue number2
DOIs
Publication statusPublished - Jan 1 1988

ASJC Scopus subject areas

  • Virology

Fingerprint Dive into the research topics of 'Molecular cloning, complete nucleotide sequence, and gene structure of the provirus genome of a retrovirus produced in a human lymphoblastoid cell line'. Together they form a unique fingerprint.

  • Cite this